DPCfam | MC23197
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 260 ± 24 aa |
| Residues in low-complexity regions (%) | 6.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12623 |
| Sequences matching dominant architecture (%) | 85.11 |
| Average overlap percent | 91.24 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G2NFY3 | 1-298 | 298 | MFLTISTTGSPERPATDLGFLLHKHPGKAQAFSTSHGTAHVFYPEASEERCTAALLLEVDPVALVRRGKGKGRGGAPDAALAQYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EVX7-F1 | 14-275 | 96.97 | 82.77 | View in AlphaFoldDB ↗ |