DPCfam | MC231969
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 199 ± 21 aa |
| Residues in low-complexity regions (%) | 11.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.93 |
| Average transmembrane regions | 0.98 |
| Dominant Pfam architecture(s) | PF13365 |
| Sequences matching dominant architecture (%) | 80.0 |
| Average overlap percent | 13.84 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R9MJP7 | 14-204 | 191 | EKGQEAYSFLQEVIKDETVSRRRLKVGILRLLGCGAIFGAAASVVFCAFTPWIEPHVNNNPKQVEIPKDEEEDQPDKEPEEEEKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34358-F1 | 76-197 | 60.53 | 70.34 | View in AlphaFoldDB ↗ |