DPCfam | MC231844
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 57 ± 7 aa |
| Residues in low-complexity regions (%) | 0.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.71 |
| Average transmembrane regions | 1.53 |
| Dominant Pfam architecture(s) | PF01733 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 30.42 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B9FXW1 | 9-69 | 61 | MIYVLTLSIFPGFLAEDTGTHSLGSWYALVLIATFNVSDLIGRYMPLIEQIKLTSRKWLLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1L5J4-F1 | 257-315 | 98.33 | 94.68 | View in AlphaFoldDB ↗ |