DPCfam | MC23172
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 209 ± 29 aa |
| Residues in low-complexity regions (%) | 7.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.69 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000937AA67 | 388-670 | 283 | SRQTSSPCLGDFITHSLKSKSRKSTAAGANNSKETSGAGKSLFADNDFPGLQASMQSSTPGNEQPNRSKKRVTPITVSKTLTSRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IWY9-F1 | 171-375 | 99.02 | 56.66 | View in AlphaFoldDB ↗ |