DPCfam | MC231232
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 198 ± 27 aa |
| Residues in low-complexity regions (%) | 2.57 |
| Residues in coiled-coil regions (%) | 1.66 |
| Predicted disordered residues (%) | 18.85 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05470 |
| Sequences matching dominant architecture (%) | 93.94 |
| Average overlap percent | 42.52 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E4WZK8 | 442-624 | 183 | KLDTEYSKLLQNSDQHSEEYRLRLSNNHKIMQIFEEATEWAISQKKKQQICQMYLLKVKYIYYRHDSQKGAEGGQQKIEQFCKYI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6P1V4-F1 | 442-637 | 100.00 | 82.31 | View in AlphaFoldDB ↗ |