DPCfam | MC231141
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 118 ± 21 aa |
| Residues in low-complexity regions (%) | 15.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.77 |
| Average transmembrane regions | 0.71 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8IP00 | 70-197 | 127 | MSSGICSQGLVLATAMVVSSTVIFLTFSRQKTLSPPKQTLRSCLSSDGKKRDKKRKKKVQFAENVKETSGNGQEYRKEQHNKVIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LZX7-F1 | 6-144 | 98.43 | 66.30 | View in AlphaFoldDB ↗ |