DPCfam | MC231133
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 100 ± 15 aa |
| Residues in low-complexity regions (%) | 0.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.89 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF05922 |
| Sequences matching dominant architecture (%) | 3.7 |
| Average overlap percent | 81.47 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A169WEN6 | 316-430 | 115 | TEMAPLFPGCDYEHWLIVMDKPGGEGATKDQMIKCYIETLAKVLGSEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7N4C7-F1 | 180-279 | 98.04 | 75.41 | View in AlphaFoldDB ↗ |