DPCfam | MC231046
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 12461 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Residues in low-complexity regions (%) | 1.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.24 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13676 |
| Sequences matching dominant architecture (%) | 56.69 |
| Average overlap percent | 81.81 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A3I1A7 | 6-127 | 122 | IFVSYRRQDASGEAGRLVDHLQEVFGDDTVFLDVETIEAGLDFVQAIDKALNSCKVLIALIGPHWLNIKDSEGNPRLFHEGDFIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0JXY0-F1 | 21-120 | 76.47 | 86.93 | View in AlphaFoldDB ↗ |