DPCfam | MC230789
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 178 ± 14 aa |
| Residues in low-complexity regions (%) | 0.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07690 |
| Sequences matching dominant architecture (%) | 1.47 |
| Average overlap percent | 1.64 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165K318 | 512-691 | 179 | MTNEEFGLRHYPTDRAHLFRSDGREITWEEYFIGDKGGELRQLFGKPEDDHGFSSDSFVPRYKTISVFGSTEITRFQFMPICEHW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H445-F1 | 497-689 | 100.00 | 91.51 | View in AlphaFoldDB ↗ |