DPCfam | MC230770
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Residues in low-complexity regions (%) | 3.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.41 |
| Average transmembrane regions | 1.03 |
| Dominant Pfam architecture(s) | PF09773 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 13.42 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000739C44E | 108-182 | 75 | FFLEVVGFSNLALMDSSSSLTRSSESYIAPWSRILRFGVSVAIAFLQIIFFAVFYERFVEDKLSQFVDLCCVSNI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BR76-F1 | 691-774 | 97.67 | 93.42 | View in AlphaFoldDB ↗ |