DPCfam | MC230673
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 56 ± 11 aa |
| Residues in low-complexity regions (%) | 3.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07714 |
| Sequences matching dominant architecture (%) | 88.46 |
| Average overlap percent | 10.7 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P6B8T5 | 925-993 | 69 | AKSKENTAKMTMVMSGYEDSEPLRPSHVKPNLAKLRIVKEAELRRGGILGYGAFGTVYKGVWVPEGENV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q61527-F1 | 683-741 | 85.42 | 63.82 | View in AlphaFoldDB ↗ |