DPCfam | MC230666
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Residues in low-complexity regions (%) | 1.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.89 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF08308 |
| Sequences matching dominant architecture (%) | 1.11 |
| Average overlap percent | 72.6 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I2QK67 | 9-96 | 88 | IRFVRPSQYADRLRSYELWVNGTSVGKLARNDALEVTLPAGACTIEATIDWGRSQPLIVRTTPGQIVEIEVRNRWGAWAALWAIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I087-F1 | 58-131 | 77.17 | 90.83 | View in AlphaFoldDB ↗ |