DPCfam | MC23053
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 159 ± 18 aa |
| Residues in low-complexity regions (%) | 10.12 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 10.3 |
| Average transmembrane regions | 2.3 |
| Dominant Pfam architecture(s) | PF12046 |
| Sequences matching dominant architecture (%) | 94.55 |
| Average overlap percent | 94.29 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0YQL7 | 10-175 | 166 | FVLTALLAVGLFFFIKASVKDRIQQEKLIAQQEAESLLTQLQAYFSSRAYRVAQTNPAENQITYEGLVRPSLFLAIFLTLLTAVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C6TBU5-F1 | 93-253 | 98.77 | 79.84 | View in AlphaFoldDB ↗ |