DPCfam | MC230468
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 141 ± 12 aa |
| Residues in low-complexity regions (%) | 8.62 |
| Residues in coiled-coil regions (%) | 7.58 |
| Predicted disordered residues (%) | 25.95 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L8GMG9 | 1311-1470 | 160 | SEDMTPPPSFELTEEEEVQKLRKEKLRKEYYFAVEEEEAAVRRRLGLLKLHSMSHVFKELKRSAEDTYKPIQDWIGSRFLTQIKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2IA00-F1 | 1339-1476 | 99.28 | 86.77 | View in AlphaFoldDB ↗ |