DPCfam | MC23034
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 55 ± 9 aa |
| Residues in low-complexity regions (%) | 3.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 64.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182I7N6 | 6-65 | 60 | IMTLSRGPYSELDKMSLFQDLKLKRRKVDSRCSSDGESIAETSTSSPDLLQPVSPKMCDQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W539-F1 | 1-58 | 93.55 | 39.59 | View in AlphaFoldDB ↗ |