DPCfam | MC230293
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 631 |
|---|---|
| Mean domain length (aa) | 184 ± 23 aa |
| Residues in low-complexity regions (%) | 2.0 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 21.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18135 |
| Sequences matching dominant architecture (%) | 99.6 |
| Average overlap percent | 57.06 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P6XJN0 | 870-1069 | 200 | DYINIVCQKLRLTWIDDGKGDQDATLGPEDLFHYIYAIFHSAIYRDRYIEFLETDYPHIPLTTNKTLFFSLIQLGSELVDYHLLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FJG7-F1 | 55-257 | 98.33 | 94.94 | View in AlphaFoldDB ↗ |