DPCfam | MC229973
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Residues in low-complexity regions (%) | 1.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.55 |
| Average transmembrane regions | 0.13 |
| Dominant Pfam architecture(s) | PF02074 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 18.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0T8GA53 | 102-167 | 66 | LGIKPKTDRDGVLQDGHWYGGAFGYFPSYNLGFIYAAQLREAVIKDHPHFDEIISSQNLSPIANWQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8U3L0-F1 | 391-462 | 98.63 | 97.96 | View in AlphaFoldDB ↗ |