DPCfam | MC229777
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Residues in low-complexity regions (%) | 0.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006443A6C | 974-1054 | 81 | MGLMQFGPAEKFQEKDQVFVYMKHHATITDTTMCEPHYNQAVSSSRPFERRRYQFLTAQDVDSYWFDLLCVCLNTPLGLIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q12789-F1 | 975-1052 | 100.00 | 83.41 | View in AlphaFoldDB ↗ |