DPCfam | MC22959
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Residues in low-complexity regions (%) | 2.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08850 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 93.82 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S7XZ68 | 3-102 | 100 | KKSLYKVHFLSRGSVYEIYAKHISQSNLFGFIEIEGLIFGKAGSVVVDPSEERLRNEFSDVKRFFVPLHSVLRIDEVEKRGVARI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HX39-F1 | 6-102 | 98.97 | 88.73 | View in AlphaFoldDB ↗ |