DPCfam | MC229265
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Residues in low-complexity regions (%) | 13.81 |
| Residues in coiled-coil regions (%) | 20.04 |
| Predicted disordered residues (%) | 15.48 |
| Average transmembrane regions | 0.91 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E3I533 | 10-108 | 99 | LAVRQLSTTAVRREEAAAVGTVGAVPVKRPVGGFRGGILGFFFGFSFASALSIYYLQEETKVATGLLTSSIEQLQQGTGKITTHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GRD9-F1 | 37-109 | 91.25 | 75.52 | View in AlphaFoldDB ↗ |