DPCfam | MC229229
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 329 ± 27 aa |
| Residues in low-complexity regions (%) | 2.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.9 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A167J415 | 4-317 | 314 | FLEETLAKIQLKHSDLSSLILILPSKRAGGFLKHHLRQNASKTFFAPKILSIEEFIETLSDLSIIDTTELMFKSFESYQATTSIT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q92I70-F1 | 7-147 | 41.77 | 84.58 | View in AlphaFoldDB ↗ |