DPCfam | MC2292
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Residues in low-complexity regions (%) | 8.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067QWV7 | 977-1059 | 83 | STQPDYTQVSPAKLALRRHLSQEKLAAASAQQLQALGSGEKGLVATRTIGDLVSGEIERTLEISNQSIINAAVDMSTMMSATT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8INR6-F1 | 1323-1400 | 98.68 | 38.73 | View in AlphaFoldDB ↗ |