DPCfam | MC229027
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 18751 |
|---|---|
| Mean domain length (aa) | 405 ± 81 aa |
| Residues in low-complexity regions (%) | 4.46 |
| Residues in coiled-coil regions (%) | 1.02 |
| Predicted disordered residues (%) | 27.54 |
| Average transmembrane regions | 0.28 |
| Dominant Pfam architecture(s) | PF00172- PF04082 |
| Sequences matching dominant architecture (%) | 53.54 |
| Average overlap percent | 90.41 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151VGX7 | 121-519 | 399 | KDKNRKLSCKECRRLKLKCDRVFPCQSCVKRGCGSLCPEGALTSGRGSRFILANTEQLHEKITQLSDRIRDLEDALRTLQSAHSN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CG84-F1 | 15-421 | 86.86 | 70.05 | View in AlphaFoldDB ↗ |