DPCfam | MC22902
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Residues in low-complexity regions (%) | 0.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06986 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 38.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067AFK8 | 30-129 | 100 | YWQVTTEEAEKLAEANECHEINRVCLDAGNKTFSDKYIINRPCWQEKISYQCYSEPQAGCKHLKSQGCQLENSTCLKRHGNICLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GW63-F1 | 351-436 | 95.29 | 91.12 | View in AlphaFoldDB ↗ |