DPCfam | MC228824
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Residues in low-complexity regions (%) | 2.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07800 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 38.92 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q0D6Y1 | 33-97 | 65 | LNEKLRTCSHDSCKFVGTYEQLREHARTAHLLAKPAHVDLSRKRTWDRLEREQEVGDVISAIRSQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1KA51-F1 | 159-216 | 98.31 | 89.63 | View in AlphaFoldDB ↗ |