DPCfam | MC228765
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 1004 ± 112 aa |
| Residues in low-complexity regions (%) | 2.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.99 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF14874 |
| Sequences matching dominant architecture (%) | 15.29 |
| Average overlap percent | 6.59 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q3PRD1 | 99-1102 | 1004 | EIESEINFGTVIANSKVISKAISIANHGSSSGTFKVSYDGVVLLNIEPIRGVVEPKSRKTVKVDVCTDVPRIIKEVIKVDLEGHG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DQB9-F1 | 11-459 | 46.71 | 75.44 | View in AlphaFoldDB ↗ |