DPCfam | MC22859
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1521 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Residues in low-complexity regions (%) | 1.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07804 |
| Sequences matching dominant architecture (%) | 98.74 |
| Average overlap percent | 44.03 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A172RZW8 | 282-389 | 108 | LLRDTVEQPVEDAIEFAKRLAFNYAVGNADAHLKNSSLLYDREWKKRRLAPMYDVTCIPLSGYSTQMPFDFGAHRAMDDIDERDI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55564-F1 | 288-390 | 94.17 | 96.67 | View in AlphaFoldDB ↗ |