DPCfam | MC228199
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Residues in low-complexity regions (%) | 1.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11681 |
| Sequences matching dominant architecture (%) | 57.89 |
| Average overlap percent | 87.15 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V9HHV6 | 12-136 | 125 | HDIVLTIGGIPYALKDYGNDTKATIAYEQDFRTEITGTDGAGTTSENHNRNAIVTVKILQSSPLNAVLQTAAYSGEQFLLAHIDK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GNN3-F1 | 3-139 | 98.47 | 94.33 | View in AlphaFoldDB ↗ |