DPCfam | MC228111
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Residues in low-complexity regions (%) | 1.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.58 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06650 |
| Sequences matching dominant architecture (%) | 90.54 |
| Average overlap percent | 3.02 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146NAQ6 | 2309-2460 | 152 | LDYACDEPTLPPYITLTVKGAGSSEVTADMNNFREYNKLYYENFIYIAATHTFPQNVERKAVGKRRLESCAELVLDVDPKTQRVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N4U329-F1 | 1365-1511 | 99.39 | 80.02 | View in AlphaFoldDB ↗ |