DPCfam | MC228025
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 751 |
|---|---|
| Mean domain length (aa) | 411 ± 33 aa |
| Residues in low-complexity regions (%) | 10.09 |
| Residues in coiled-coil regions (%) | 0.88 |
| Predicted disordered residues (%) | 4.67 |
| Average transmembrane regions | 8.71 |
| Dominant Pfam architecture(s) | PF09913 |
| Sequences matching dominant architecture (%) | 91.34 |
| Average overlap percent | 88.08 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A174BD64 | 208-616 | 409 | DDQIHYSNALSTSYLFETQKTDTDIKFTDEAVRRAQGYEEPSLSHFDRAEILEHARQLNGSYRSDIASGHVQVNKHEEFVYTLSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EMC6-F1 | 66-487 | 97.88 | 95.10 | View in AlphaFoldDB ↗ |