DPCfam | MC227372
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 58 ± 7 aa |
| Residues in low-complexity regions (%) | 1.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07745 |
| Sequences matching dominant architecture (%) | 93.62 |
| Average overlap percent | 14.3 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1T4JA90 | 536-593 | 58 | GTGWATAAAEGYLPDRNMYWVDPATGERKATWGGSSWDNAGLFDINGVALKSLDFYKD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O07013-F1 | 365-424 | 91.55 | 98.17 | View in AlphaFoldDB ↗ |