DPCfam | MC22737
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 174 ± 22 aa |
| Residues in low-complexity regions (%) | 14.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 66.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13136 |
| Sequences matching dominant architecture (%) | 97.18 |
| Average overlap percent | 56.93 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N1HYX4 | 19-193 | 175 | PHRRSHPNIQHLSLAPLTPRYPIDPADYLAYHDPTTSTLHTSTSISHIAALPTPGGILTNSPARSRANSRTRLKRKVKSHVNIAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PP28-F1 | 13-202 | 98.84 | 51.62 | View in AlphaFoldDB ↗ |