DPCfam | MC227345
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Residues in low-complexity regions (%) | 2.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000719BA38 | 90-180 | 91 | LYAMFMGRLSHSIFKWDQDYLDALKRAKRAEMEAQNISAPSDADVMRRLHRKELALHCRTTRGAEETITLISQLIEAMDGERGRD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9QF11-F1 | 387-474 | 98.96 | 86.34 | View in AlphaFoldDB ↗ |