DPCfam | MC227241
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 249 ± 40 aa |
| Residues in low-complexity regions (%) | 3.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00150- PF03442 |
| Sequences matching dominant architecture (%) | 45.0 |
| Average overlap percent | 40.52 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L2G6B7 | 283-533 | 251 | ADKASMKNDLAVVRGNFTDVPLVIGEFDASPLNTEPAARWKWTDHFVRTAAELNTALIIWDNGLDHLDRNAHSWRDLTSLAIVKN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P23550-F1 | 277-533 | 98.09 | 97.81 | View in AlphaFoldDB ↗ |