DPCfam | MC226852
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Residues in low-complexity regions (%) | 4.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.04 |
| Average transmembrane regions | 0.53 |
| Dominant Pfam architecture(s) | PF18159 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 44.21 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A192LRR9 | 170-305 | 136 | MWVPVVYVVALFPLALAQDLSFQDMVLNVVSPFSAVLIWSVRERYRQLDAISANDALRADVESAWTQLIPDSENPAEDSESRARQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FKG1-F1 | 137-250 | 96.72 | 88.79 | View in AlphaFoldDB ↗ |