DPCfam | MC226835
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 981 |
|---|---|
| Mean domain length (aa) | 242 ± 24 aa |
| Residues in low-complexity regions (%) | 8.16 |
| Residues in coiled-coil regions (%) | 3.63 |
| Predicted disordered residues (%) | 5.38 |
| Average transmembrane regions | 4.9 |
| Dominant Pfam architecture(s) | PF00664 |
| Sequences matching dominant architecture (%) | 2.27 |
| Average overlap percent | 3.86 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00071E4AE5 | 27-260 | 234 | SSNNGSWPQFTDCFQKTVLVWIPCGWLFLTLPYYSYYLITTRGKSRHITFFSILKTLLSFLLAVFVLCDLIVNIYYENTHVTAVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7KTC0-F1 | 13-284 | 99.58 | 82.61 | View in AlphaFoldDB ↗ |