DPCfam | MC226751
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 58 ± 8 aa |
| Residues in low-complexity regions (%) | 0.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16021 |
| Sequences matching dominant architecture (%) | 96.47 |
| Average overlap percent | 40.81 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9WTY1 | 417-480 | 64 | LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWATAIQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4ACM6-F1 | 194-251 | 95.08 | 82.42 | View in AlphaFoldDB ↗ |