DPCfam | MC226433
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Residues in low-complexity regions (%) | 1.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.46 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02774 |
| Sequences matching dominant architecture (%) | 99.59 |
| Average overlap percent | 48.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6LNU3 | 184-286 | 103 | AAETKVYDKQIAFNCLPHIDEFLDNGYTKEEMKMVSETQKILGDGNIRVNPTCVRVSVFYGHAEALHVETSQPVNIEEATRLLDE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O67716-F1 | 190-272 | 97.65 | 98.30 | View in AlphaFoldDB ↗ |