DPCfam | MC22635
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Residues in low-complexity regions (%) | 0.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13920 |
| Sequences matching dominant architecture (%) | 64.29 |
| Average overlap percent | 14.02 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3YYU7 | 186-254 | 68 | SRSQSCPFCRDSLKRVNSGDLWVYMDNKDVVDMTTITRENLRRLFMYIEKLPLIVPDNVFDHYDTHIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7MA46-F1 | 179-246 | 100.00 | 82.67 | View in AlphaFoldDB ↗ |