DPCfam | MC22623
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Residues in low-complexity regions (%) | 1.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14610 |
| Sequences matching dominant architecture (%) | 7.04 |
| Average overlap percent | 64.58 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J4I070 | 57-192 | 136 | TIDDEAQISEALQACFDSNNGVFSCYPESNTVVAQHEWAGFVWNTRLPQFTETNQVDVYLYNADSLTPVLSFLGQTNPSTTAGQV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9USH0-F1 | 76-151 | 66.94 | 92.80 | View in AlphaFoldDB ↗ |