DPCfam | MC226112
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Residues in low-complexity regions (%) | 4.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.43 |
| Average transmembrane regions | 1.88 |
| Dominant Pfam architecture(s) | PF01040 |
| Sequences matching dominant architecture (%) | 93.81 |
| Average overlap percent | 41.2 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D8QLV3 | 54-147 | 94 | LLCSGLVILTTLHAQDFAGIEGDRALGRRSFPVRSPQLSRACVYMDVALWSFLLACAWSMTWMGFLGLGLVVARRFCSFLSIVEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WBU8-F1 | 188-286 | 99.00 | 97.16 | View in AlphaFoldDB ↗ |