DPCfam | MC22597
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03837 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.44 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X7ENU0 | 111-176 | 66 | QFQLGYRGLIDLARRTGEITSVYAHEVYEGDEFEYSYGLEKDLKHKPTGEEDGDKITHFYAVYKLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P33228-F1 | 114-180 | 100.00 | 94.39 | View in AlphaFoldDB ↗ |