DPCfam | MC225945
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 433 ± 69 aa |
| Residues in low-complexity regions (%) | 1.3 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 21.68 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12520 |
| Sequences matching dominant architecture (%) | 72.92 |
| Average overlap percent | 84.96 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178ELV5 | 10-350 | 341 | TISQYYRSHTPLSDGEKYLHIRFYEREHNEIEAQRWRGLLSKSKAKNLNQIKRNKWLLDCFDKLEPFRALWAGFQLGSFPPILSW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2DQ07-F1 | 24-516 | 99.57 | 87.88 | View in AlphaFoldDB ↗ |