DPCfam | MC225942
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 465 ± 70 aa |
| Residues in low-complexity regions (%) | 4.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.34 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05406 |
| Sequences matching dominant architecture (%) | 54.76 |
| Average overlap percent | 15.35 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J1BZL9 | 1-419 | 419 | MKLIKQIKLFYKEGNSDKVYEIDLCSIDADNYVVNFRYGKRGSVLKEGTKTPEYVSADKAQVIFDKLENEKKGKGYASEIETLIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6CHJ7-F1 | 152-269 | 23.94 | 95.81 | View in AlphaFoldDB ↗ |