DPCfam | MC225604
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Residues in low-complexity regions (%) | 1.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06630 |
| Sequences matching dominant architecture (%) | 97.92 |
| Average overlap percent | 55.67 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00076B6B8B | 8-94 | 87 | FLVRKAKKSSGQKDAVLWCSDDFESANATLDYLLIKSGAKLKDYFKAVATNFPVVNELPPEGELSLTFCDFYQLGSDNMTWAQIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P15032-F1 | 7-98 | 98.94 | 88.27 | View in AlphaFoldDB ↗ |