DPCfam | MC225595
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 541 |
|---|---|
| Mean domain length (aa) | 178 ± 28 aa |
| Residues in low-complexity regions (%) | 2.71 |
| Residues in coiled-coil regions (%) | 0.19 |
| Predicted disordered residues (%) | 1.66 |
| Average transmembrane regions | 3.97 |
| Dominant Pfam architecture(s) | PF04387 |
| Sequences matching dominant architecture (%) | 95.88 |
| Average overlap percent | 77.31 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A132NX32 | 5-153 | 149 | YLSLYNVVQTILWSLALILVTIWTPARSDKLDLYICMAQSTMILDIVHVALGLTRGGLLTTTLQILSRLVVVWFAVHDSRATAES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZEJ0-F1 | 16-213 | 99.46 | 84.55 | View in AlphaFoldDB ↗ |