DPCfam | MC22539
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Residues in low-complexity regions (%) | 2.27 |
| Residues in coiled-coil regions (%) | 10.0 |
| Predicted disordered residues (%) | 27.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16489 |
| Sequences matching dominant architecture (%) | 5.0 |
| Average overlap percent | 14.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3C5V0 | 461-569 | 109 | EDIICKDDRFGTGRTGDQSTIWCDEGLEGSITAVCEGSGNWKTGEDTCIVTAIKELLIFSEQLTEVGVPEFAGALNAVVQSNKSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5RHM6-F1 | 282-391 | 98.21 | 85.58 | View in AlphaFoldDB ↗ |