DPCfam | MC225386
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Residues in low-complexity regions (%) | 3.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09606 |
| Sequences matching dominant architecture (%) | 92.55 |
| Average overlap percent | 42.47 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B3B00EB | 550-703 | 154 | DALNGPEMRNLPTPQKIPKLEEPPMEIPDVLQGEIARLDSRFKVSLEPMSYFGGGGGAISLIAALDEPRLPCVAGVHVSVPRDYP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5TP13-F1 | 633-746 | 83.82 | 88.88 | View in AlphaFoldDB ↗ |