DPCfam | MC225283
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 135 ± 33 aa |
| Residues in low-complexity regions (%) | 6.9 |
| Residues in coiled-coil regions (%) | 2.62 |
| Predicted disordered residues (%) | 14.76 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0W0PGE9 | 1-95 | 95 | MAILMQLTLGGYTQYLYVKPETEQGKHCVKELDAKVSQYEQRTQDAMRSQQASYDFQMIGYRACTQQTLLPQPCGSEHVDPSAAQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I082-F1 | 26-133 | 94.44 | 87.72 | View in AlphaFoldDB ↗ |