DPCfam | MC225216
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 4961 |
|---|---|
| Mean domain length (aa) | 257 ± 45 aa |
| Residues in low-complexity regions (%) | 3.51 |
| Residues in coiled-coil regions (%) | 2.48 |
| Predicted disordered residues (%) | 9.22 |
| Average transmembrane regions | 2.51 |
| Dominant Pfam architecture(s) | PF02931- PF02932 |
| Sequences matching dominant architecture (%) | 57.57 |
| Average overlap percent | 79.4 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00067500B0 | 50-326 | 277 | GNYNPDVRPCTNYSTPLNITATLHLSTVQDLDIKNQVMKLIGYISFTWIDEQLRWNESDYGYITDMLLPQKKIWRPDMAIYNSVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158N8C1-F1 | 67-332 | 91.62 | 89.43 | View in AlphaFoldDB ↗ |